TRAIL receptor-2 |
TRAIL receptor-4 |
DQDEGNFRRFPTNAVSMSADENSPFDLSNEDGAVYQRDL |
||
abbr. TRAIL-R3. This human receptor (299 amino acids) for the cytotoxic ligand TRAIL belongs to the TNF receptor superfamily. The receptor is referred to also as TRID [TRAIL receptor without an intracellular domain]. The gene maps to human chromosome 8p22-21, clustered with the genes encoding two other TRAIL receptors.
Transcripts for this receptor are detectable only in peripheral blood lymphocytes and spleen.
Unlike the related TRAIL receptor-2 TRAIL receptor-3 does not contain a cytoplasmic death domain necessary for the induction of apoptosis. Because of its lack of a death domain
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |