TNF receptor-related protein |
TNF receptor superfamily member 1A |
TNEIVEEQYTPQSLATLESVFQELGKLTGPNNQ |
||
[tumor necrosis factor receptor superfamily] Members of this family of transmembrane glycoproteins show features of the TNF receptor family. They have cysteine-rich repeats of about 40 amino acids in the extracellular amino terminal. Some members of the family also show sequence similarities in their cytoplasmic regions. Some members of this family possess a region of homology in their intracellular domains known as the death domain.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |