tyro2 |
tyro3 family receptors |
QEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKS |
||
[tyrosine-protein kinase 3] A murine growth factor receptor tyrosine kinase (Lai and Lemke, 1991; Lai et al, 1994) isolated by using an anti-phosphotyrosine antibody screening procedure. tyro3 belongs to the Axl/Ufo growth factor receptor family and is known also as sky, rse, brt, dtk, or tif. See also: TAM receptors.
A study of the expression of dtk during ontogeny of the hematopoietic system shows that dtk is expressed abundantly in differentiating embryonic stem cells, yolk sac blood islands, para-aortic splanchnopleural mesoderm, fractionated AA4(+)
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |