sFRP4 |
SFSIIHTPILPL |
SHQDCYEALHKCMASHSKPFSCSMKFHMCLQQQ |
||
[secreted frizzled-related protein 5] This protein, which is being referred to also as FRP5 [frizzled-related protein 5], is a member of a family of secreted proteins that appear to act as soluble modulators of Wnt family signaling. They compete with membrane-bound receptors belonging to the frizzled family for the binding of secreted Wnt family ligands (Jones and Jomary, 2002). The gene has been identified independently as SARP-3 (Melkonyan et al, 1997).
The bovine sFRP5 gene has been cloned by Chang et al (1999). These authors have identified also the human homolog. sFRP5 is expressed highly in retinal pigment epithelium cells
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |