RYHMQCGYRGTFCTPGKCPHGNAYLGLCRPKYSCCRWL |
ryk1 |
Staphylococcus aureus mprF |
||
Another designation is ryk1. Ryk is an oncogene identified originally in the genome of the RPL30 virus, an acute oncogenic avian retrovirus isolated from chicken tumors (Jia et al, 1992). The corresponding human ryk tyrosine kinase (607 amino acids) (Hovens et al, 1992; Tamagnone et al, 1993) has been found to represent a ubiquitously expressed gene. Comparison of the human and mouse ryk sequences shows a 92 % conservation at the nucleotide level and 97 % at the amino acid level. The human ryk gene maps to chromosome 3q11-25 (Stacker et al, 1993).
Ryk is a member of the growth factor receptor protein tyrosine kinases
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |