Rs-AFP4 |
RS cells |
DTLIGSCVWGATNYTSDCNAECKRRGYKGGHCGSFLNVNCWCE |
||
[randomly sequenced cDNA 786] In the nomenclature of CD antigens this protein has been given the designation CD281.
The protein has been identified by Mitcham et al (1996) by virtue of its homology with the signaling domain of the type 1 IL1 receptor. High levels of the protein are expressed by resting human monocytes. In vitro exposure to bacterial lipopolysaccharides inhibits rsc786 expression (Saccani et al, 1998).
For additional information on CD antigens see also: CD antigens Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |