ribosomal protein L31 |
ribosomal protein L35 |
HSDAIFTEEYSKLLAKLALQKYLASILGSRTSPPP |
||
abbr. and approved gene symbol: RPL32. This protein is a component of the 60S subunit of ribosomes (60S ribosomal protein L32) (Kenmochi et al, 1998). For gene structure see also: Yoshihama et al (2002). The rat gene has been described by Rajchel et al (1988). The mouse gene has been characterized by Dudov and Perry (1984).
Role as moonlighting protein
Apart from its role as a structural component of the 60S ribosome subunit, ribosomal protein L32 has other functions and thus can be regarded as a member of a growing group of proteins referred to as moonlighting proteins.
Ito Y (1992) have purified a protein, termed BIP [bone-inducing protein], from a murine
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |