pyroptosis |
Pyrrhocoricin |
KGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLE |
||
[pyroptosomes]
A pyroptosome - coined in analogy with inflammasome, necrosome - is a unique large supramolecular assembly, distinct from the inflammasome, that is formed after stimulation of macrophages and monocytes with several pro-inflammatory stimuli.
The pyroptosome is composed largely of oligomerized dimers of the adaptor protein ASC and triggers the rapid recruitment and activation of caspase-1. This results in cell death by pyroptosis and the release of the intracellular pro-inflammatory cytokines. Unlike the inflammasome, which forms a ring-like structure with an outer diameter of approximately 13 nm, the pyroptosome appears as a single (one
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |