prolactin family 8 subfamily A member 2 |
prolactin family 8 subfamily A member 4 |
IWDAIFHGAKHFLHRLVNPGGKDAVKDVQQKQ |
||
abbr. Prl8a3. Proposed designation (Soares et al, 2007) for rat PLP-Cv [PRL-like protein C variant]. See: PLP-C [Prolactin-like protein C, Placental prolactin-like protein C, PRL-like protein C].
See also: hormones/neuropeptide MiniCOPE dictionary for hormonally active proteins, peptides, neuropeptides, regulatory peptides, prohormones and their receptors.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |