Pilosulin-5 |
PILOT |
ECP(1-45) |
||
a family of allergenic polypeptides found in the venom of the Australian jumper ant Myrmecia pilosula (Davies et al, 2004; Inagaki et al, 2004). Pilosulin-1 (GLGSVFGRLARILGRVIPKVAKKLGPKVAKVLPKVMKEAIPMAVEMAKSQEEQQPQ) and Pilosulin-2 (IDWKKVDWKKVSKKTCKVMLKACKFLG] are the major peptides. Pilosulin-1 is identical with Myr p I allergen, the major allergen peptide of these ants (Donovan et al, 1993). Pilosulin-2 has been identified as the ant Myr p II allergen (Street et al, 1993).
Pilosulin-3 (IIGLVSKGTCVLVKTVCKKVLKQG) and Pilosulin-4 (
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |