Paracrine growth-stimulatory factor |
paracrines |
VRNFVTCRINRGFCVPIRCPGHRRQIGTCLGPQIKCCR |
||
a term pertaining to one of several mechanisms causing cell death by apoptosis in nearby cells by a paracrine mechanism and involving a death receptor and its cognate ligand. It is observed, for example between T-cells expressing and secreting FAS antigen and target cells expressing the FAS ligand, the binding of which to its receptor triggers cell death. For other mechanisms see also: autocrine suicide, fratricide.
For other entries pertaining to cell death mechanisms see also the Apoptosis and Cell Death Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |