PHLDA2 |
pHLIP variant 3 |
sprouty-2 |
||
[pH low insertion peptide] pHLIP is a cell-penetrating peptide with pH-dependent transmembrane ability. It is derived from the C-helix of the integral membrane protein bacteriorhodopsin. The sequence, HNGEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT contains a transmembrane domain (WARYADWLFTTPLLLLDLALLV) with titratable acidic residues that are responsible for fully reversible pH-dependent transmembrane activity (Hunt et al, 1997). The term often referred to as WT-pHLIP (for wild-type pHLIP) is used frequently for the sequence ACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGT. Weerakkody et al (2013 have reported the design of 16 pHLIP peptide
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |