Myocardial ischemic preconditioning up-regulated protein 2 |
Myocardin-related transcription factor A |
KRFHSVGSLIQRHQQMIRDKSEATRHGIRIITRPKLLLAS |
||
specialized myocardial cells that contribute to the expression of electrical activity in the intact myocardium (Anyukhovsky et al, 1999).
For related information of interest see also: Cell types Dictionary, Cell lines in Cytokine Research, Cell culture.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |