LUCA-15 |
Lucifensin II |
KPYCSCKWRCGIGEEEKGICHKFPIVTYVCCRRP |
||
[Lucilia defensin] Lucifensin (ATCDLLSGTGVKHSACAAHCLLRGNRGGYCNGRAICVCRN) is an insect defensin purified from the extracts of various tissues (gut, salivary glands, fat body, haemolymph) of green bottle fly (Lucilia sericata) larvae and from their excretions/secretions. The primary sequence is very similar to that of sapecin and other dipteran defensins. It is thought that lucifensin is the key antimicrobial component that protects maggots when they are exposed to the highly infectious environment of a wound during the medicinal process known as maggot debridement therapy (Cerovský V et al, 2010).
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |