Fortilin |
fos induced growth factor |
KKISQRYQKFALPQYLKTVYQHQKAMKPWIQPKTKVIPY |
||
c-fos is the cellular homolog of the viral v-fos oncogene found in FBJ (Finkel-Biskis-Jinkins) and FBR murine osteosarcoma viruses (MSV).
The human fos gene maps to chromosome 14q21-q31. fos has been identified as TIS28, a gene inducible in several cell types by Phorbol esters (see also: TIS genes).
c-fos is thought to have an important role in signal transduction, cell proliferation, and differentiation. It is a nuclear protein which, in combination with other transcription factors (see, for example: jun) acts as a trans-activating regulator of
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |