DICTNCCAGTKGCNTTSANGAFICEGQSDPKKPKACPLNCDPHIAYA |
Dicynthaurin |
myeloid nuclear differentiation antigen |
||
[dictyocyte]
As reviewed by Nonaka et al (2005), these cells, termed also fibroblastic reticulum cells or myeoid cells, are components of an entity referred to as inflammatory myofibroblastic tumor, and the author suggests that the neoplastic spindle cell component of these tumours may be derived from thes subtypes of cells of the accessory immune system.
For related information of interest see also: Cell types Dictionary, Cell lines in Cytokine Research, Cell culture.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |