Day 12 CFU-S |
DAYPSGAW |
MSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPT |
||
This protein is one of the Caspases found in Drosophila melanogaster that functions during cell death by apoptosis (Vernooy et al, 2000). See: DAMM [Death associated molecule related to Mch2]
For other entries pertaining to cell death mechanisms see also the Apoptosis and Cell Death Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |