dAct |
dactylidin |
GILDSFKQFAKGVGKDLIKGAAQGVLSTMSCKLAKTC |
||
[Drosophila Activin; abbr. dAct] dActivin is encoded by the CG11062 gene and encodes the Drosophila ortholog of Activin-beta (Inhibin-beta) (Kutty et al, 1998; Haerry and O'Connor, 2002). The factor acts through the Babo receptor and controls several aspects of neuronal morphogenesis during development (Zheng et al, 2003; Zhu et al, 2008; Ting et al, 2007). Sander et al (2010) have implicated dActivin signaling involving the SMAD protein dSmad2 in Drosophila wing development, where it antagonizes dpp and Mad signaling.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |