casein-kappa(42-49) |
casein-kappa(58-61) |
membrane transducing peptides |
||
Also: kappa-casein(43-97). This bioactive peptide with the sequence YQRRPAIAINNPYVPRTYYANPAVVRPHAQIPQRQYLPNSHPPTVVRRPNLHPSF is derived from bovine casein-kappa by enzymatic hydrolysis. The peptide may act as a defense peptide that shows antimicrobial activity and is active against Gram-positive Staphylococcus carnosus and Gram-negative Escherichia coli (Liepke et al, 2001).
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |