Calpactin-1 light chain |
Calpactin p11 |
AKLNAEKLKDFKIRLQYFARGLQVYIRQLRLALQGKT |
||
This protein of 35 kDa has been identified by Glenney (1986). It interacts with phospholipid and actin and reacts with antibodies to the 35 kDa substrate of the epidermal growth factor receptor. The protein can be phosphorylated by the EGF receptor (Glenney and Zokas, 1988; Blay et al, 1989) and by protein kinase C (Barnes et al, 1991).
Amino-terminal sequence analysis shows that Calpactin-2 is related to Calpactin-1 and that Calpactin-2 is identical with human lipocortin (lipocortin-1) (Glenney et al, 1987). Thus it is the same as Annexin-1.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |