calliFMRFamides |
Calliphora vomitoria myosuppressin |
RTCMKKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC |
||
This proline-rich and arginine-rich antimicrobial peptide of 32 amino acids (WNSNRRFRVGRPPVVGRPGCVCFRAPCPCSNYamide) has been described by Noga et al (2011). It is produced by hemocytes of the blue crab. The primary structure of callinectin is highly similar to arasins (see: Arasin 1).
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |