buforin IIb |
bullfrog pepsinogen A-derived antimicrobial peptide |
nemosis |
||
Buforin-1 (AGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNY) has been isolated from the stomach tissue of the Asian toad Bufo bufo gargarizans (for review see: Cho et al, 2009). Its amino acid sequence is identical in 37 of 39 amino-terminal residues with Xenopus laevis histone H2A (Park et al, 1996) (for bioactive fragments of histone proteins see also: HDAPs [Histone-derived antimicrobial peptides]).
Buforin-1 shows strong antimicrobial activities in vitro against a broad-spectrum of microorganisms and is more potent than magainin-2 (Giacometti et al, 1999, 2000; Park et al, 1996).
Buforin-2
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |