BOB |
Boc-AEVD-CHO |
CFITKALGISYGRKKRRQRRRPPQGSQTHQVSLSKQ |
||
[bovine oligosaccharide-binding protein] This protein is a bovine ortholog (169 amino acids) of peptidoglycan binding protein identified in other species (see: PGRP). It has been purified from peripheral leukocytes. The mature protein is stored in the cytoplasmic granules of neutrophils and eosinophils but is absent from lymphocytes, monocytes, and platelets. bOBP is microbicidal for Gram-positive bacteria and Gram-negative bacteria and yeast at low micromolar concentrations
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |