anti-idiotypic B-cells |
Anti-inflammatory peptide-1 |
KAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYL |
||
[anti-inflammatory cytokine]
a general term for those immunoregulatory cytokines that counteract various aspects of inflammation, for example cell activation or the production of pro-inflammatory cytokines, and thus contribute to the control of the magnitude of the inflammatory responses in vivo. These mediators act mainly by the inhibition of the production of pro-inflammatory cytokines or by counteracting many biological effects of pro-inflammatory mediators in different ways. The major anti-inflammatory cytokines are IL4, IL10, and IL13, and IL35. Other anti-inflammatory mediators include IL16, IFN-alpha,
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |