ALF |
alfalfa antifungal peptide |
v-myb |
||
[alfalfa antifungal peptide] alfAFP (RTCENLADKYRGPCFSGCDTHCTTKENAVSGRCRDDFRCWCTKRC) is a plant defensin isolated from seeds of Medicago sativa. It shows strong activity against the agronomically important fungal pathogen Verticillium dahliae. Expression of alfAFP in transgenic potato plants provides robust resistance against the pathogen.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |