agranular light cells |
AGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNY |
Cell proliferation-inducing gene 32 protein |
||
[agranulocyte, agranulocytic]
a general collective term for some cell types of the hematopoietic system (see also: hematopoiesis). These cell types, which are known collectively also as monomorphonuclear leukocytes or mononuclear leukocytes, or mononuclear cells. These cell types include lymphocytes, plasma cells, monocytes and macrophages, mast cells. These cells differ from granulocytes in that they do not contain lysosomal granules in their cytoplasm. Their nuclei are not lobated.
For related information of interest see also: Cell types Dictionary,
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |