ADEEDKSQVPLVRVRRGFGCPFNQYQCHSHCLSIGRRGGYCGGSFKTTCTCYN |
A-delta fibers |
opioid-somatostatin-like receptor 8 |
||
[adelomorphous cell]
(from Greek: 'lacking a defined form, indefinite or obscure in form') This term has been used in older references for chief cells of the gastric epithelium. See: gastric chief cells.
For related information of interest see also: Cell types Dictionary, Cell lines in Cytokine Research, Cell culture.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |