COPE Media Kit


Cope Home
Previous entry:
ABAE cell growth-inhibitory activity
Next entry:
abalone intestine gastrointestinal digest peptide
Random entry:
Serotonin-containing enterochromaffin cells
Search COPE:

abaecin

abaecin (34 amino acids; YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY) is a major antibacterial response peptide in the honeybee (Apis mellifera) (Casteels et al, 1990). Abaecin has a broad spectrum of antibacterial activities, specific activities against Gram-negative plant pathogens that are lowers than those of other bee peptides (apidaecins), and is incapable of inhibiting bacterial growth at medium ionic strengths. The highest observed specific activity is against an apidaecin-resistant Xanthomonas strain. Expression of the peptide is induced after challenge of honey bees with the natural pathogen Paenibacillus larvae larvae (Evans and Lopez, 2004).

A 39 residue abaecin (FVPYNPPRPGQSKPFPSFPGHGPFNPKIQWPYPLPNPGH ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: November 2012



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=680