COPE Media Kit


Cope Home
Previous entry:
Y RNA-derived small RNAs
Next entry:
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY
Random entry:
Phenylpyruvate tautomerase(11-27)
Search COPE:

Y RNAs

[Y RNA]

These small non-coding RNAs (100 ± 20 nucleotides) were discovered as components of cytoplasmic ribonucleoproteins associated with autoantigens (Ro60 and La proteins) in patients suffering from the autoimmune diseases systemic lupus erythematosus and Sjögren's syndrome (Hendrick et al, 1981; Lerner et al, 1981). These RNAs fold into characteristic stem-loop secondary structures in which the 5′ and 3′ RNA ends hybridise to form predominantly double-stranded upper and lower stem domains with an internal loop (Teunissen et al, 2000; van Gelder et al, 1994). Y RNAs are found in a variety of metazoans (Perreault et al, 2007) and are homologous in structure and function with non-coding stem-bulge RNAs (abbr. sbRNAs) in nematodes ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: AUGUST 2018



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=54586