XPF |
XPN |
KSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
||
a constitutively exported high molecular weight form of aFGF sequestered as a latent form into the conditioned medium by tumor cell lines derived from highly angiogenic beta-cell tumors of transgenic mice. These forms lack mitogenic activity and heparin affinity and represent tight aggregates of aFGF. Brefeldin A, an inhibitor of conventional secretion, does not interfere with protein export, and the export pathway does not involve cell lysis or apoptosis.
This form of aFGF may play a role in tumor growth and angiogenesis.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |