TRAC1 |
tracheocytes |
Miple2 |
||
abbr. TAP (approved gene symbol) (a term with multiple meanings). This bovine antimicrobial peptide (NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK) has been isolated from bovine tracheal mucosa by Diamond et al (1991). The peptide is a member of the Beta-Defensin family of antimicrobial peptides and its homolog is beta-Defensin-2.
Tracheal antimicrobial peptide has antibacterial activity in vitro against Escherichia coli
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |