Th3 T-cells |
Th5 helper cells |
ALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
||
[Th5 cell, Th5]
[T-helper 5 cells; Th5 helper cells; Th5 T-cells] These cells constitute a subpopulation of T-helper cells described by Kurowska-Stolarska et al (2008). These cells produce mainly IL5, but not IL4, both of which are characteristic type 2 cytokines produced by Th2 T-helper cells.
Th5 cells are generated from murine and human naive CD4(+) T-cells by IL33 in the presence of antigen. This polarization requires the IL1 receptor-related receptor ST2
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |