TSG-1 |
TSG-8 |
SFGLCRLRRGFCAHGRCRFPSIPIGRCSRFVQCCRRVW |
||
[tumor necrosis factor-stimulated gene sequence-6] TSG-6 has been identified originally as one of the TSG genes induced rapidly and transiently after treatment of human fibroblasts with TNF-alpha for three hours (Lee et al, 1990). TSG-6 is a secretory protein (277 amino acids) that been identified as a member of the hyaluronate binding protein family (Lee et al, 1992). Another designation is TNFAIP6 [tumor necrosis factor-alpha-induced protein 6] or TNFIP6 [tumor necrosis factor-induced protein 6]. The protein contains a CUB domain, characteristic for developmentally regulated proteins. The rabbit
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |