sialorphin |
sialostatin L2 |
EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA |
||
A databank designation for Sialostatin L is Salivary cystatin-L. This protein is a secreted salivary cystatin from the tick Ixodes scapularis, the main vector of Lyme disease (Kotsyfakis M et al, 2006). For a related protein see also: Sialostatin L2.
Sialostatin L inhibits cathepsin L and some other members of the cathepsin family, has anti-inflammatory and immunosuppressive activity, and inhibits the proliferation of cytotoxic T-cells.
Lieskovská et al (2015) have reported that Sialostatin L influences the maturation of dendritic cells thus having impact on adaptive immune response. Sialostatin L strongly blocks the production of the chemokine MIP-1-alpha in Borrelia-infected bone-marrow derived
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |