ST-HSC |
STI1 |
ADEEDKSQVPLVRVRRGFGCPFNQYQCHSHCLSIGRRGGYCGGSFKTTCTCYN |
||
[Salmonella typhimurium-derived T-cell inhibitor] A Bacteriokine encoded in the genome of Salmonella typhimurium. STI is a protein of 81.5 kDa (765 amino acids). Homology analysis reveals that the amino acid sequence of STI is highly homologous with beta-glucosidase of Escherichia coli K-12.
STI inhibits T-cell responsiveness to IL2 and has been shown to inhibit growth of CTLL-2 cells in response to IL2. Growth inhibition appears to involve downregulation of IL2 receptor expression, affecting the beta and the gamma chain of the receptor.
For other relevant entries see also the Pathogenicity/Virulence Factors Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |