COPE Media Kit


Cope Home
Previous entry:
ST-HSC
Next entry:
STI1
Random entry:
ADEEDKSQVPLVRVRRGFGCPFNQYQCHSHCLSIGRRGGYCGGSFKTTCTCYN
Search COPE:

STI

[Salmonella typhimurium-derived T-cell inhibitor] A Bacteriokine encoded in the genome of Salmonella typhimurium. STI is a protein of 81.5 kDa (765 amino acids). Homology analysis reveals that the amino acid sequence of STI is highly homologous with beta-glucosidase of Escherichia coli K-12.

STI inhibits T-cell responsiveness to IL2 and has been shown to inhibit growth of CTLL-2 cells in response to IL2. Growth inhibition appears to involve downregulation of IL2 receptor expression, affecting the beta and the gamma chain of the receptor.

For other relevant entries see also the Pathogenicity/Virulence Factors Dictionary section of this encyclopedia.

... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: August 2008



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=47929