STC |
STC2 |
KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTIPF |
||
[stanniocalcin 1] This is the same as STC [stanniocalcin] (renamed STC1 following the identification of a related protein, STC2).
STC1 is a hypocalcemic, calcium-regulated hormone (Chang et al, 1995; Olsen et al, 1996) involved in the regulation of calcium levels, identified originally as hypocalcin or teleocalcin in bony fish, in which corpuscles of Stannius, endocrine glands associated with the kidneys are major organs of production (Lafeber et al, 1988; Wagner et al, 1986).
Olsen et al (1996) and Chang et al (1995) have isolated a human cDNA clone encoding the mammalian
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |