SRDLICYCRKGGCNRGEQVYGTCSGRLLFCCRRRHRH |
SREB3 |
MMIF |
||
[SREs]
[serum response element] A short sequence found in the promoter regions of a number of cytokine genes and genes the expression of which is stimulated by cytokines and growth factors (see, for example: Egr-1) (see also: gene expression). This sequence element mediates the inducible expression of these genes by several external and intracellular signaling molecules including serum (and factors contained therein), 12-O-tetradecanoyl-phorbol-13-acetate (see also: Phorbol esters), cAMP, and membrane-associated tyrosine kinases such as src, fps, raf, and ras.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |