S-PTTH |
SPUF protein |
GLGSVFGRLARILGRVIPKVAKKLGPKVAKVLPKVMKEAIPMAVEMAKSQEEQQPQ |
||
This peptide has been identified in hydrolysates of goat milk casein treated with trypsin / chymotrypsin (Zhang et al, 2015). The peptide has been shown to inhibit the activity of DPP4 [dipeptidyl peptidase 4] (CD26).
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |