SPINK4 |
SPINK5L3 |
VLSPADKTNVKAAWGKVGAHAGEYGAEALERMF |
||
[Serine protease inhibitor Kazal-type 13]. A databank synonym is SPINK5L3 [Serine protease inhibitor Kazal-type 5-like 3].
This rat protein, identified originally in Macaca mulatta as an epididymis-specific gene termed ESC6 [epididymis-specific clone 6] (Liu et al, 2001), has been identified by Ma et al (2013) as an androgen-responsive serine protease inhibitor that binds to the sperm acrosome region and is essential for sperm maturation. Knock-down of SPINK13 in vivo dramatically enhances the acrosomal exocytosis during capacitation and significantly reduces male fertility.
The protein has been identified independently as
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |