SDNFMRFamide |
SDPR |
GFGCPWNRYQCHSHCRSIGRLGGYCAGSLRLTCTCYRS |
||
[Stem cell-Derived Neural stem/progenitor cell Supporting Factor; Neural stem cell-derived neuronal survival protein] This factor is secreted into the conditioned medium of adult neural stem/progenitor cell, a cell type that mediates adult neurogenesis in the mammalian central nervous system. Rat SDNSF expression has been localized to the hippocampus including dentate gyrus, where neurogenesis persists throughout life (Toda et al, 2003).
Adult neural stem/progenitor cells can be kept in culture and can be expanded in media supplemented by EGF or bFGF. SDNSF allows these cells to survive after withdrawal of bFGF. Under these conditions the
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |