SCYB8 |
SCYB9B |
SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP |
||
[small inducible cytokine subfamily B member 9] older designation of the gene encoding the protein known as mig [monokine induced by gamma-Interferon], which is a member of the CXC-Chemokines. The factor is known also as CRG-10. The approved gene symbol is CXCL9. See also: SCY family of cytokines.
This factor is known mainly because of its chemotactic activity. For an unrelated function as an antimicrobial peptide in innate immunity see: CXCL9. For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |