sex peptide receptor |
Sez627 |
GWKDWAKKAGGWLKKKGPGMAKAALKAAMQ |
||
abbr. SAF (a term with multiple meanings). This factor of 28 kDa has been found to be produced by mitogen-activated peripheral blood mononuclear cells from four of five patients with Sézary syndrome, a leukemic form of cutaneous T-cell lymphoma characterized by circulating neoplastic CD4(+) T-cells. T-cells derived from these patients normally proliferate poorly in response to conventional mitogens for T-cells. SAF renders non-proliferating resting T-cells from leukemic patients and healthy donors responsive to IL2 in the absence of a costimulator.
Several cytokines
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |