pp65(340-355) |
Pp-AMP 2 |
hypocalcin |
||
[Phyllostachys pubescens antimicrobial peptide 1] Pp-AMP1 (KSCCRSTQARNIYNAPRFAGGSRPLCALGSGCKIVDDKKTPPND) is a chitin-binding peptide with antimicrobial activity against pathogenic bacteria and fungi purified from Japanese bamboo shoots (Phyllostachys pubescens) (Fujimura et al, 2005). The peptide has the common structural features of the plant defensin family but cannot be grouped in any type of that family. It shows a high degree of homology to mistletoe toxins. For a closely related peptide see also: Pp-AMP-2.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |