PSG17 |
PSG23 |
VAAKWKDDVIKLCGRELVRAQIAICGMSTWS |
||
[pregnancy-specific glycoprotein 18] This murine glycoprotein, which is being referred to also as CEA3 [carcinoembryonic antigen 3] in sequence databanks, is a member of a larger family of pregnancy-specific glycoproteins secreted by the placenta (McLellan et al, 2005). Wessells et al (2000) have reported that PSG18 induces the expression of IL10 in murine macrophages, but does not affect the expression of IL1-beta, TNF-alpha, inducible NO synthase, IL12-p40 and TGF-beta.
Kawano et al (2007) have reported that PSG18 is expressed highly and exclusively in the follicle-associated epithelium
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |