PLP |
PLP-A |
ESDTVTCRKMKGKCSFLLCPFFKRSSGTCYNGLAKCCRPFW |
||
[papain-like protease 2] This enzyme is encoded by human coronavirus NL63, which causes croup in children and is associated with pneumonia in the elderly (Van der Hoek et al, 2005).
PLP2 is contained within the nonstructural protein 3 (nsp3), which is expressed as part of a replicase polyprotein. PLP2 participates in the cleavage of the replicase polyprotein. This generates nonstructural proteins that associate with ER membranes to generate convoluted membranes and double membrane vesicles, which are the site of viral replication (Knoops et al, 2008). The analysis of the enzymatic activity and structural studies have shown that PLP2 functions as a protease and a deubiquitinating enzyme (Clementz et al, 2010; Lindner et al, 2005; Ratia et al, 2006; Chen et al, 2007).
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |