COPE Media Kit


Cope Home
Previous entry:
PLP
Next entry:
PLP-A
Random entry:
ESDTVTCRKMKGKCSFLLCPFFKRSSGTCYNGLAKCCRPFW
Search COPE:

PLP2

[papain-like protease 2] This enzyme is encoded by human coronavirus NL63, which causes croup in children and is associated with pneumonia in the elderly (Van der Hoek et al, 2005).

PLP2 is contained within the nonstructural protein 3 (nsp3), which is expressed as part of a replicase polyprotein. PLP2 participates in the cleavage of the replicase polyprotein. This generates nonstructural proteins that associate with ER membranes to generate convoluted membranes and double membrane vesicles, which are the site of viral replication (Knoops et al, 2008). The analysis of the enzymatic activity and structural studies have shown that PLP2 functions as a protease and a deubiquitinating enzyme (Clementz et al, 2010; Lindner et al, 2005; Ratia et al, 2006; Chen et al, 2007).

... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: April 2012



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=40845