mel-CSPG |
melectin |
viral PYPAF1 |
||
Note: not to be confused with the mycotoxin of the same name isolated as a secondary metabolite from various Penicillium species.
Meleagrin peptide (QVLKYCPKIGYCSSKCSKAEVWAYSPDCKVHCCVPANQKW) has been identified in ovomucin preparations from turkey (Meleagris gallopavo) (Odani et al, 1989). The sequence is related to that of Cygnin, and both proteins have been grouped as members of a family of avian proteins related to Beta-Defensins, referred to as ovodefensins (Gong et al, 2010). It is not known whether the peptide plays a role in host defense as direct antibacterial activity has not been demonstrated.
For other proteins/peptides with functions in innate immunity
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |