Mb-type bipolar cells |
MBWE |
NEPVSCIRNGGICQYRCIGLRHKIGTCGSPFKCCK |
||
This mouse gene has been identified by Yang et al (2007). The mbu-1 gene is only expressed in the brain and spinal cord during the embryonic stages, and throughout all regions of the adult brain, showing higher levels in the hippocampus and hypothalamus. The absence of transcripts in other tissues may be due to promoter methylation. Treatment with 5-aza-2'-deoxycytidine (5-Aza-dC) significantly decreases promoter methylation and has been shown to reactivate Mbu-1 expression in NG108-15 and Neuro-2a neuronal cells.
Sequence analysis shows that Mbu is the mouse counterpart of CSRNP3 [Cysteine/serine-rich nuclear protein 3] (see: TAIP-2 [TGF-beta-induced apoptosis protein 2]).
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |