My-1 |
MY7 |
AQCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNCR |
||
The MY4 antigen is named after the monoclonal antibody derived from a fusion of the NS-1 plasmacytoma cell line with splenocytes from a mouse immunized with human acute myelomonocytic leukemia cells. MY4 defines a myeloid differentiation antigen in that it is not detected on myeloid precursor cells and appears at discrete stages of differentiation. The antigen is not expressed by lymphocytes, erythrocytes, platelets, or lymphoid malignancies. MY4 is expressed by normal monocytes and by greater than 90 % of patients with acute monocytic leukemia or acute myelomonocytic leukemia
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |