MLGATSL |
MLGYNFSSFPCGTISIAPGFFNFYRLYFIWVNGLAKVVW |
orfK12 |
||
This peptide corresponds to the first 21 amino acids of HEBP1 [heme-binding protein-1]. See: FPRL2 [formyl peptide receptor-like-2, FPR-like-2].
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |