Miz-1 |
MJ7/18 antigen |
LSEDMPATPADQEMYQPDPEEMESRTRYFSPRL |
||
These cells, identified by Malchow et al (2013), constitute an endogenous population of antigen-specific regulatory T-cells found recurrently enriched in the tumors of mice with oncogene-driven prostate cancer. These cells are not reactive to a tumor-specific antigen but instead recognize a prostate-associated self antigen that is present in tumor-free mice. The cells undergo thymic development in both male and female mice, and this process depends on AIRE [autoimmune regulator]. AIRE-mediated expression of peripheral tissue antigens drives the thymic development of this subset of organ-specific regulatory T-cells. Thus, instead of de novo conversion of tumor-specific CD4(+) effector T-cells into induced FOXP3(+)
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |